
Hier finden Sie eine Übersicht unserer Leistungen. Klicken Sie einfach auf eine der Leistungen für mehr Informationen.





Komplette Check-Up-Untersuchung, bestehend aus einer ausführlichen körperlichen Untersuchung (bei Männern inklusive der Krebsvorsorge an den Geschlechtsorganen), dem Herz-Kreislauf-Check mit dem Ruhe- und Belastungs-EKG, dem Herzultraschall, dem Bauch- und Schilddrüsen-Ultraschall, dem Lungenfunktionstest per Spirometrie, dem Osteoporosetest per Knochendichtemessung, der Stuhluntersuchung auf Blut im Stuhl, einer ausführlichen Blut- und Urinuntersuchung inklusive der wichtigsten Tumormarker. Auf Wunsch zusätzlich Untersuchung der zum Gehirn führenden Gefäße per Ultraschall (Gefäßduplex) zur Schlaganfallsprophylaxe und des Darmes (Vorsorge-Darmspiegelung) zur Dickdarmkrebs-Prophylaxe. Hautkrebs-Screening zum Ausschluss von Hauttumoren. Diese Untersuchungen werden von den Privatversicherungen komplett übernommen. Bei gesetzlich versicherten Patienten handelt es sich hierbei um so genannte IGEL-Leistungen (individuelle Gesundheitsleistungen), die selbst bezahlt werden müssen.


Vorsorgekoloskopie ab einem Lebensalter von 50 Jahren bei Männern und 55 Jahren bei Frauen (bei Privatpatienten keine Altersbegrenzung), Hautkrebs-Screening (s.d.), Untersuchungen bei Gesundheits-Check up (s.d.)

Gesundheits-Check-Up für gesetzlich Versicherte:

Für alle Versicherten zwischen 17 und 34 Jahren einmal der "Check up 17".
Ab einem Lebensalter von 35 Jahren alle 3 Jahre Bei HZV-Patienten( Vertrag mit Hausarzt zentrierter Versorgung) Check up alle 2 Jahre  Beinhaltet  Ganzkörperuntersuchung, Urinuntersuchung per Stix, Blutbestimmung der Risikofaktoren Cholesterin und Blutzucker und die Blutdruckmessung. Zusätzliche Leistungen wie beim Manager-Check-Up können nur bei entsprechenden Beschwerden bzw. chronischen Erkrankungen oder als IGEL-Leistung (s.o.) angeboten werden.


Nachweis von Tumormarkern zur Früherkennung von Brustkrebs-, Eierstocks-, Prostata-, Magen-Darm- und Bauchspeicheldrüsenkrebs im Blut. Nachweis des Tumormarkers ( UBC Rapid Test: Urinary Bladder Cancer Antigen Rapid Test) zur Früherkennung von Harnblasenkrebs im Urin.


Ab einem Alter von 35 Jahren alle 2 Jahre bei gesetzlich Versicherten.
Bei Privatpatienten keine Altersbeschränkung.
Untersuchung der kompletten Hautoberfläche zum Ausschluss von Hauttumoren.


Krebsvorsorge beim Mann

Ab einem Lebensalter von 45 Jahren jährlich.
Bei Privatpatienten keine Altersbeschränkung.
Untersuchung der Geschlechtsorgane einschließlich Abtastung der Prostata und Stuhluntersuchung ( iFOBT:immunologischer Test auf okkultes Blut im Stuhl, der zuverlässig menschliches Blut im Stuhl erkennt, ab dem Alter von 50 J. jährlich bis 54 J., ab 55 J. alle 2 Jahre).
Auf Wunsch kann eine Bestimmung des PSA-Wertes (spezifischer Tumormarker im Blut bei Prostatakrebs) durchgeführt werden.
Der PSA-Wert ist dabei keine gesetzliche Kassenleistung.


Es handelt sich um ein Schallausbreitungsgeschwindigkeitsmessverfahren (SOS) per Omnisense, das bei der Vorhersage von Frakturen (Knochenbrüchen) und der Erkennung einer Osteoporose (Knochenschwund) am peripheren Knochen eine hohe Sensitivität aufweist.
Es kann beliebig oft ohne Strahlenbelastung (im Gegensatz zum CT) beim Patienten wiederholt werden. An verschiedenen Messpunkten (Finger, Unterarm, Unterschenkel, Fuß) wird die Dichtigkeit der Knochen gemessen. Keine Kassenleistung.



Wir führen neben der Farbultraschalluntersuchung der Schilddrüse auch endokrinologische Untersuchungen der Schilddrüse durch: Wir bestimmen die "freien" Schilddrüsenhormone (FT3, FT4) und das Schilddrüsen stimulierende Hormon (TSH) im Blut. Bei grenzwertigen Befunden führen wir einen TRH-Test durch. Hierbei wird dem Patienten ein TSH stimulierendes Hormon (TRH) mittels eines Nasensprays verabreicht und das TSH-Hormon vor und 30 Min. nach der TRH-Gabe per Blutentnahme bestimmt. Der Test dient dem Nachweis einer Schilddrüsenunterfunktion, einer verminderten Stimulierbarkeit von TSH im Gehirn und zur Therapiekontrolle unter medikamentöser Therapie. Auch Bestimmungen von Schilddrüsenantikörpern zum Nachweis von Autoimmunerkrankungen der Schilddrüse
(Erkr., bei denen der Körper Antikörper gegen das eigene Schilddrüsengewebe bildet)
und die Bestimmung von Tumormarkern bei Krebsverdacht und als Tumornachsorge werden durchgeführt.


Ultraschalldarstellung und Größenmessung der Schilddrüse, Erkennung von Knoten und Zysten.


Ultraschalldarstellung aller Bauchorgane und des Darmes.


Endoskopische Darstellung der Speiseröhre, des Magens und des Zwölffingerdarmes mit dem Video-Gastroskop (schmaler flexibler Schlauch, der über den lokal betäubten Rachen eingeführt wird). Erkennung eines Zwerchfellbruches ,von Entzündungen, Polypen(Schleimhautwucherungen, mögl. Vorstufen des Magenkrebses) oder Magenkrebs. Nachweis von Helicobacterbakterien und Lamblien (=Magenbeschwerden verursachende Krankheitserreger). Möglichkeit der Probeentnahme bei krankhaften Befunden. Fotodokumentation. Die Untersuchung kann ohne oder unter Sedierung (Schlafzustand durch eine Beruhigungsspritze mit dem Tranquilizer Midazolam (Dormicum)) durchgeführt werden. Die Untersuchung dauert in der Regel 5-10 Minuten. Nach der Untersuchung mit Dämmerschlaf wird der Patient im Aufwachraum noch 30 Minuten überwacht. Zur Hygienereinigung und Prüfung siehe Darmspiegelung.


Sie dient der Vorsorge (ab dem Alter von 50 J. bei Männern, ab dem Alter von 55 J. bei Frauen zweimal im Mindestabstand von 10 J., bei Wahrnehmung  der Vorsorgekoloskopie ab 65 J. einmal eine Vorsorgekoloskopie) zur Aufdeckung von Polypen, Schleimhautwucherungen, die meist eine Vorstufe des Darmkrebses darstellen oder bereits Krebszellen beinhalten, oder der Aufdeckung von Darmerkrankungen bei entsprechenden Beschwerden.  (Koloskopie dann jederzeit möglich!)

Endoskopische Darstellung des gesamten Dickdarms mit Einsehen des Endteils des Dünndarms mit dem Video-Koloskop (flexibler schmaler Schlauch, der nach Verabreichung eines Gleitgels über den After eingeführt wird). Entnahme von Proben aus krankhaften Befunden und Hochfrequenz-Schlingen-Abtragung von Polypen. Zur genauen Beurteilung von verdächtigen Arealen ist eine andere Farbdarstellung durch Veränderung der Wellenlängenbereiche des Lichtes (sog. virtuelle Chromoendoskopie) möglich. Die Untersuchung wird in der Regel unter Sedierung (Schlafzustand durch eine Beruhigungsspritze mit dem Tranquilizer Midazolam (Dormicum)) durchgeführt. Darunter findet eine kontinuierliche Sauerstoff- und Kreislaufüberwachung statt. Der Patient schläft entspannt bei Wellness-Musik ein und empfindet darunter keinen Schmerz. Die bei der Untersuchung eingegebene harmlose Raumluft wird beim Rückzug wieder abgesaugt bzw. entweicht geruchlos über den After, sodass Blähungsbeschwerden nach der Untersuchung sehr selten sind. 

Eine Alternative wäre eine Kohlenstoffdioxidgas-Aufdehnung des Darmes. Dieses Gas wird direkt über die Darmwand aufgenommen und über die Gefäße durch das Herz in die Lungen transportiert und dann abgeatmet. Dadurch sollen nach der Untersuchung Blähungsbeschwerden seltener auftreten. Kohlenstoffdioxid wird normalerweise von unserem Körper abgeatmet, da es für den Körper in höheren Konzentrationen giftig ist. Daher haben wir uns bewusst gegen dieses Verfahren entschieden, da besonders Herz- und Lungenkranke durch eine höhere Kohlenstoffdioxidkonzentration bei erschwerter Abatmung des Gases gefährdet sind.
Die durchschnittliche Untersuchungsdauer liegt bei 20-30 Minuten. Nach der Untersuchung mit Dämmerschlaf wird der Patient noch 30 Min. im Aufwachraum überwacht. Die Endoskopreinigung erfolgt über eine moderne elektronische Waschmaschine. Die Endoskopvorreinigung und Desinfektion wird nur von einer in der Hygiene geschulten medizinischen Fachangestellten durchgeführt. Weiteres s."Praxis".





Immunologischer Stuhltest auf okkultes Blut im Stuhl, der zuverlässig menschliches Blut im Stuhl erkennt. Bei Privatpatienten gibt es hierfür keine Altersbeschränkung. Gesetzlich Versicherte haben gemäß der Krebsfrüherkennungs-Richtlinie ab dem Alter von 50 Jahren die Möglichkeit, diesen Test jährlich bis zum Alter von 54 Jahren durchführen zu lassen. Ab dem Alter von 55 Jahren haben Frauen und Männer alle 2 Jahre Anspruch auf diesen Test, solange noch keine Früherkennungskoloskopie in Anspruch genommen wurde. 





Calprotectin im Stuhl ist ein wichtiger Indikator für die Aktivität chronisch entzündlicher Darmerkrankungen.
Bei Entzündungen des Darmgewebes gelangen vermehrt weiße Blutkörperchen in den Darmraum.
In der Folge wird Calprotectin aus den weißen Blutkörperchen freigesetzt und somit im Stuhl messbar.


Lactose- / Fructose-Intoleranztest

Dient dem Nachweis oder Ausschluss einer Milchzucker- oder Fruchtzucker- Intoleranz (Unverträglichkeit) bei Bauchbeschwerden mit Blähungen. Man trinkt auf nüchternem Magen eine bestimmte Menge des in Wasser gelösten Zuckers und nimmt in regelmäßigen Abständen Atemproben. Wird der entsprechende Zucker nicht abgebaut, wird er durch Darmbakterien unter Bildung von Wasserstoff zersetzt. Dieser gelangt über den Darm und den Blutkreislauf in die Lunge und wird dort abgeatmet. Der Wasserstoffanstieg kann dann in der Atemprobe gemessen werden.


Antikörperbestimmungen im Blut auf multiple Allergene (Allergieauslöser) werden durchgeführt.


Test zur Messung und Aufzeichnung des Lungen- bzw. Atemvolumens, der Luftflussgeschwindigkeit und des Atemwegswiderstands.
Hiermit kann u.a. ein Asthma, eine chronische Bronchitis oder eine Blählunge (Lungenemphysem) diagnostiziert werden.
Bei der Untersuchung atmet der Patient durch ein steriles Einmalmundstück mit Bakterienfilter über ein-Schlauch-System in ein geschlossenes Behältnis ein und aus.


Funktionelle Schwarz-Weiß- und Farb-Ultraschalldarstellung der Herzhöhlen, der Herzklappen, des Herzbeutels, der Herzwände, Messung der Wanddicke, der Pumpfunktion des Herzens, des Schlagvolumens. Erkennung von Narben nach Herzinfarkten, Thromben (Gerinnsel), Herzklappenfehlern und Funktionsstörungen, wie z. B. Rechts- und Linkskammer-Herzschwächen etc.


Überprüfung und Programmierung aller Schrittmacherfunktionen.

Pro-BNP-Hormon Bestimmung

Dieses Hormon wird von der Herzkammer bei Überlastung und Überfüllung des Herzens ausgeschüttet und bewirkt die Ausscheidung von Flüssigkeit über die Niere und die
Erweiterung von Blutgefäßen und reguliert so das Herz-Kreislauf-System. Die Bestimmung des BNP-Spiegels im Blut wird zur Beurteilung der Herzschwäche
und zur Abschätzung der Schwere anderer Herz-Kreislauf-Erkrankungen eingesetzt und kann vielleicht aufwändigere Herzuntersuchungen unnötig machen.


Darstellung des Stromkurvenverlaufes der Erregungsbildung und Erregungsausbreitung des Reizleitungssystems des Herzens.
Gibt Rückschlüsse auf die Durchblutung des Herzmuskels, Narben nach Herzinfarkt und Herzrhythmusstörungen.


24 Stunden-Aufzeichnung des EKGs. Zeigt Herzrhythmusstörungen.


Aufzeichnung der EKG-Kurven unter Belastung auf einem Standfahrrad in aufrechter Sitzposition.
Zeigt Hinweise auf Durchblutungsstörungen der Herzkranzgefäße und Rhythmusstörungen unter Belastung.


24 Stunden-Aufzeichnung des Blutdruckes.

Ultraschall der Beingefäße

Ultraschall-Farbdarstellung der Arterien und Venen der Beine. Erkennung von Arteriosklerosen (Kalkeinlagerungen) in den Arterien und Darstellung von Funktionsstörungen in Venen und Krampfadern sowie Darstellung von alten oder frischen Thrombosen. Abschätzung der Thrombosegefahr und Stellung der Operationsindikation. Auch entzündliche
Gefäßerkrankungen können abgeklärt werden.

Ultraschall der hirnversorgenden Gefäße

Ultraschall-Farbdarstellung der zum Gehirn und zu den Augen führenden arteriellen Gefäße. Erkennung von Durchblutungsstörungen, Arteriosklerosen bzw. Kalkablagerungen in den Gefäßen und damit Abschätzung der Schlaganfallgefahr.
Nur bei Privatpatienten bzw. bei Privatzahlern.

Impf- und Reiseberatung

Werden nach den aktuellen Empfehlungen der STIKO (Ständige Impfkommission) durchgeführt.
Ein regelmäßig aktualisiertes Impfüberwachungsprogramm unserer Computersoftware überwacht die notwendigen Basisimpfungen.


Wurde zum 31.12.06 im Rahmen einer ausführlichen Renovierung der Praxis eingestellt, da die Abrechnung für Kassenpatienten
nicht mehr durch Hausärzte möglich ist.
Extern angefertigte Bilder können jedoch von den Mitgliedern der Praxisgemeinschaft fachmännisch beurteilt werden.


Diese erfolgt im Rahmen der hausärztlichen Versorgung.

Psychosomatische Grundversorgung

Alle vier Ärzte haben einen einjährigen Kurs in der psychosomatischen Grundversorgung nach den Psychotherapierichtlinien der Bundesärztekammer absolviert.
So ist ein psychosomatisch orientierter Umgang mit dem Patienten besser möglich, und es können psychosoziale Ursachen vieler Krankheiten besser erkannt werden.

Disease-Management-Programm (DMP)

Dies sind strukturierte Behandlungsprogramme für chronisch kranke Patienten. Dazu zählen Diabetiker, Asthmatiker, chronische Bronchitiker, Patienten mit Herzkranzgefäßerkrankungen und hohem Blutdruck. Durch regelmäßige standardisierte Behandlungs- und Betreuungsprozesse soll die Behandlung verbessert und Folgeerkrankungen reduziert werden. Es finden regelmäßige Patientenschulungen durch geschulte medizinische Fachangestellte in unserer Praxis statt. Die Teilnahme für den Patienten ist freiwillig.


Als diabetologisch geschulte Hausärzte betreuen wir intensiv auch im Rahmen des Qualitätsmanagements unsere Diabetiker. Wir führen regelmäßig Patientenschulungen durch.


Patienten mit Asthma werden von uns ebenfalls intensiv im Qualitätsmanagement betreut. Wir führen regelmäßig Patientenschulungen durch.


Chronische Bronchitiker werden ebenfalls von uns intensiv im Qualitätsmanagement betreut. Wir führen regelmäßige Patientenschulungen durch.


Patienten mit Herz-Kranzgefäßerkrankungen, der so genannten „Koronaren Herzkrankheit“ (KHK), und hohem Blutdruck (Hypertonie) werden von uns intensiv im Qualitätsmanagement betreut. Wir führen regelmäßig Patientenschulungen durch.


Es werden kleine sterile Einmalnadeln am Ohr für vier Wochen gesetzt.
Die zur Gewichtsreduktion notwendige Diät (400kcal), die alle notwendigen Nährstoffe enthält und daher zu keinem Mangel führen soll, wird durch die Akupunktur ohne wesentliches Hungergefühl durchführbar. Die Gewichtsreduktion beträgt je nach Veranlagung und Ausgangsgewicht 5-12 kg in vier Wochen. Beim Nikotinentzug werden durch die Akupunktur Entzugsphänomene deutlich unterdrückt.


Schwarz-Weiß-Ultraschalluntersuchung nahezu aller großen und kleinen Gelenke im Körper. Hierzu zählen u.a. Schulter-, Ellenbogen- und Handgelenke, alle Fingergelenke,
die Schlüsselbein- und Brustbeingelenke, Hüft-, Knie- und Sprunggelenke sowie alle Zehengelenke. Mittels Farbbildgebung können zusätzliche Aussagen zum Ausmaß
entzündlicher Veränderungen getroffen werden. Auch können die gelenksumgebenden Strukturen wie Kapseln, Bänder, Schleimbeutel und Sehnen beurteilt werden.
Knöcherne, oft verschleißbedingte Veränderungen lassen sich häufig auch diagnostizieren.


Mit einem Auflichtmikroskop wird das Kapillarbett, also der Ort des Übergangs von sauerstoffreichem zu sauerstoffarmen Blut, im Bereich der Nagelfalz dargestellt. Mit dieser
schnellen und schmerzlosen Untersuchung können Rückschlüsse auf Durchblutungsstörungen oder auch bestimmte rheumatische Bindegewebserkrankungen ( sog. Kollagenosen) gezogen werden.